PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100237220041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 417aa    MW: 46972.1 Da    PI: 6.0828
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100237220041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.8e-31307362156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH++F++a+++LGG++ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Ote100237220041|100237220041 307 KQRRCWSPELHAQFIDALQHLGGPQAATPKQIREHMQVDGLTNDEVKSHLQKYRLH 362
                                   79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-17304365IPR009057Homeodomain-like
PROSITE profilePS5129414.062304364IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-27306366IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-26307362IPR006447Myb domain, plants
PfamPF002493.1E-8309360IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
TESSPFDPFI XXXXXXXDTS IHTDYRRREI LFINSVERDW RNLEDLVGKM GSPIHPKLGL  60
DCRFSPKQKP IGRFLADVSK IHAVSDRILK LDDYVNRLQD EMKKIDAFKR ELPLCMLLLS  120
DAISAAQEEL AEYRKLNSEP VLEQFMPLEK ICTDEKDEKV EDSTEKVMSS VDKKQWMSSV  180
QLQLWNGDDE NSNSNTAAYS SNKLSSNKKK KMGEEINQPL MDDLFGNEKQ RTFEPFKGCP  240
SFGVMAVGKG EMDDLPVPGL SLCTPGIKNS REAINPVGSS YSKSGSSPAT SNLQASFKSG  300
QVQTGRKQRR CWSPELHAQF IDALQHLGGP QAATPKQIRE HMQVDGLTND EVKSHLQKYR  360
LHMRRIASNS TSQPVTLWTS QEQFRDSLKQ STAQFGSPEG PLHLSRCPEG EGEDEDG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088301.11e-144PREDICTED: uncharacterized protein LOC105169576
TrEMBLA0A022RCD51e-114A0A022RCD5_ERYGU; Uncharacterized protein
STRINGVIT_03s0063g01060.t012e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443